Search Antibody, Protein, and ELISA Kit Solutions

RELA Antibody - middle region (ARP30371_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30371_P050-FITC Conjugated

ARP30371_P050-HRP Conjugated

ARP30371_P050-Biotin Conjugated

Gene Symbol:
RELA
Official Gene Full Name:
V-rel reticuloendotheliosis viral oncogene homolog A (avian)
NCBI Gene Id:
5970
Protein Name:
Transcription factor p65
Swissprot Id:
Q04206
Protein Accession #:
NP_068810
Nucleotide Accession #:
NM_021975
Alias Symbols:
MGC131774, NFKB3, p65
Replacement Item:
This antibody may replace item sc-109 from Santa Cruz Biotechnology.
Description of Target:
p65 is a subunit of the nuclear factor kappa-B, a second messenger, which activates the transcription of a number of genes in multiple tissues. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA, or RELB (MIM 604758) to form the NFKB complex. The p50 (NFKB1)/p65 (RELA) heterodimer is the most abundant form of NFKB. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NFKB complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1760 M62399.1 8-1767
Protein Size (# AA):
551
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RELA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RELA.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RELA
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Peptide Sequence:
Synthetic peptide located within the following region: LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GAN; CCND1; ABCA1; UBC; TCF4; SRSF7; RELA; REL; PRKDC; PLG; PEX1; NFKB2; NFKB1; MUC3A; KRT5; REV1; TXN2; FBXW11; IL1RN; IKBKB; HSPA5; HDAC1; EP300; CREBBP; MAP3K8; CHEK1; CDKN2A; CDK4; SPATA31A3; POTEJ; POTEE; PIWIL4; DIS3L2; DCD; IKBKG; CHUK; PLA2G4A; ST
Blocking Peptide:
For anti-RELA (ARP30371_P050) antibody is Catalog # AAP30371 (Previous Catalog # AAPS08809)
Datasheets/Manuals:
Printable datasheet for anti-RELA (ARP30371_P050) antibody
Sample Type Confirmation:

RELA is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Wittwer,T. (2008) Biochem. Biophys. Res. Commun. 371 (2), 294-297

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...