Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP30371_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30371_P050-FITC Conjugated

ARP30371_P050-HRP Conjugated

ARP30371_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-109 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RELA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Peptide Sequence Synthetic peptide located within the following region: LVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-RELA (ARP30371_P050) antibody is Catalog # AAP30371 (Previous Catalog # AAPS08809)
Datasheets/Manuals Printable datasheet for anti-RELA (ARP30371_P050) antibody
Sample Type Confirmation

RELA is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference Wittwer,T. (2008) Biochem. Biophys. Res. Commun. 371 (2), 294-297
Gene Symbol RELA
Official Gene Full Name V-rel reticuloendotheliosis viral oncogene homolog A (avian)
Alias Symbols MGC131774, NFKB3, p65
NCBI Gene Id 5970
Protein Name Transcription factor p65
Description of Target p65 is a subunit of the nuclear factor kappa-B, a second messenger, which activates the transcription of a number of genes in multiple tissues. The inhibitory effect of I-kappa-B upon NF-kappa-B in the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA, or RELB (MIM 604758) to form the NFKB complex. The p50 (NFKB1)/p65 (RELA) heterodimer is the most abundant form of NFKB. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NFKB complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1760 M62399.1 8-1767
Swissprot Id Q04206
Protein Accession # NP_068810
Nucleotide Accession # NM_021975
Protein Size (# AA) 551
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RELA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RELA.
Protein Interactions GAN; CCND1; ABCA1; UBC; TCF4; SRSF7; RELA; REL; PRKDC; PLG; PEX1; NFKB2; NFKB1; MUC3A; KRT5; REV1; TXN2; FBXW11; IL1RN; IKBKB; HSPA5; HDAC1; EP300; CREBBP; MAP3K8; CHEK1; CDKN2A; CDK4; SPATA31A3; POTEJ; POTEE; PIWIL4; DIS3L2; DCD; IKBKG; CHUK; PLA2G4A; ST
  1. What is the species homology for "RELA Antibody - middle region (ARP30371_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Human, Mouse, Pig, Rat".

  2. How long will it take to receive "RELA Antibody - middle region (ARP30371_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RELA Antibody - middle region (ARP30371_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RELA Antibody - middle region (ARP30371_P050)"?

    This target may also be called "MGC131774, NFKB3, p65" in publications.

  5. What is the shipping cost for "RELA Antibody - middle region (ARP30371_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RELA Antibody - middle region (ARP30371_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RELA Antibody - middle region (ARP30371_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RELA Antibody - middle region (ARP30371_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "RELA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RELA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RELA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RELA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RELA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RELA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RELA Antibody - middle region (ARP30371_P050)
Your Rating