SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100756_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-REL (P100756_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human REL
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: ASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-REL (P100756_P050) antibody is Catalog # AAP31077 (Previous Catalog # AAPP01816)
ReferenceKerppola,T.K. (er) Ann. Rheum. Dis. (2008) In press
Gene SymbolREL
Gene Full NameV-rel reticuloendotheliosis viral oncogene homolog (avian)
Alias SymbolsC-Rel, HIVEN86A
NCBI Gene Id5966
Protein NameProto-oncogene c-Rel
Description of TargetREL is a member of the Rel/NFKB family, which also includes RELA, RELB, NFKB1, and NFKB2. These proteins are related through a highly conserved N-terminal region termed the 'Rel domain,' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor.The REL gene encodes c-Rel, a transcription factor that is a member of the Rel/NFKB family, which also includes RELA (MIM 164014), RELB (604758), NFKB1 (MIM 164011), and NFKB2 (MIM 164012). These proteins are related through a highly conserved N-terminal region termed the 'Rel domain,' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor (MIM 164008) (Belguise and Sonenshein, 2007 [PubMed 18037997]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-174 CN414487.1 2-175 175-2323 X75042.1 128-2276 2324-2457 BX111941.1 575-708 2458-2592 AA279919.1 1-135 c
Uniprot IDQ04864
Protein Accession #NP_002899
Nucleotide Accession #NM_002908
Protein Size (# AA)619
Molecular Weight68kDa
Protein InteractionsNFKB2; REXO1L6P; C12orf75; TRIM74; RAB41; BARHL2; SEC14L4; NUDT14; ZDHHC24; NEIL2; CPNE2; C9orf72; STRA13; TTC21A; FUT11; ZNF564; ZNF550; PATE1; TSTD2; ZNF417; ZNF572; GLYCTK; EGLN3; RIPPLY1; ZNF765; ATPAF2; SLC39A13; BMF; KRTAP9-4; CEP19; VPS25; MIEN1; P
  1. What is the species homology for "REL Antibody - N-terminal region (P100756_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "REL Antibody - N-terminal region (P100756_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "REL Antibody - N-terminal region (P100756_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "REL Antibody - N-terminal region (P100756_P050)"?

    This target may also be called "C-Rel, HIVEN86A" in publications.

  5. What is the shipping cost for "REL Antibody - N-terminal region (P100756_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "REL Antibody - N-terminal region (P100756_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "REL Antibody - N-terminal region (P100756_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "68kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "REL Antibody - N-terminal region (P100756_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "REL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "REL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "REL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "REL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "REL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "REL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:REL Antibody - N-terminal region (P100756_P050)
Your Rating
We found other products you might like!