REL Antibody - N-terminal region : HRP (P100756_P050-HRP)

Catalog No: P100756_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human REL
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: ASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-REL (P100756_P050-HRP) antibody is Catalog # AAP31077 (Previous Catalog # AAPP01816)

Target Info

• Reference: Kerppola,T.K. (er) Ann. Rheum. Dis. (2008) In press
• Gene Symbol: REL
• Gene Full Name: V-rel reticuloendotheliosis viral oncogene homolog (avian)
• Alias Symbols: C-Rel, HIVEN86A
• NCBI Gene Id: 5966
• Protein Name: Proto-oncogene c-Rel
• Description of Target: REL is a member of the Rel/NFKB family, which also includes RELA, RELB, NFKB1, and NFKB2. These proteins are related through a highly conserved N-terminal region termed the 'Rel domain,' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor.The REL gene encodes c-Rel, a transcription factor that is a member of the Rel/NFKB family, which also includes RELA (MIM 164014), RELB (604758), NFKB1 (MIM 164011), and NFKB2 (MIM 164012). These proteins are related through a highly conserved N-terminal region termed the 'Rel domain,' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor (MIM 164008) (Belguise and Sonenshein, 2007 [PubMed 18037997]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-174 CN414487.1 2-175 175-2323 X75042.1 128-2276 2324-2457 BX111941.1 575-708 2458-2592 AA279919.1 1-135 c
• Uniprot ID: Q04864
• Protein Accession #: NP_002899
• Nucleotide Accession #: NM_002908
• Protein Size (# AA): 619
• Molecular Weight: 68kDa
• Protein Interactions: NFKB2; REXO1L6P; C12orf75; TRIM74; RAB41; BARHL2; SEC14L4; NUDT14; ZDHHC24; NEIL2; CPNE2; C9orf72; STRA13; TTC21A; FUT11; ZNF564; ZNF550; PATE1; TSTD2; ZNF417; ZNF572; GLYCTK; EGLN3; RIPPLY1; ZNF765; ATPAF2; SLC39A13; BMF; KRTAP9-4; CEP19; VPS25; MIEN1; P