Recombinant Streptavidin Protein (OPPA02060)

Catalog No: OPPA02060 (Formerly GWB-E25C10)

Size:20MG

Product Info

• Product Format: Lyophilizedin 10mM potassium phosphate buffer pH 6.5
  Physical Appearance: Sterile filtered white powder.
• Reconstitution and Storage: It is recommended to reconstitute the lyophilized Streptavidin in sterile 18MΩ-cm H₂O not less than 0.5 mg/ml, which can then be further diluted to other aqueous solutions. Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.
• Concentration: 0.5 mg/ml (prior to lyophilization)
• Purity: Greater than 98.0% as determined by SDS-PAGE and RP-HPLC.
• Biological Activity: Specific Activity: > 17 U/mg (one unit binds 1 ug D-biotin at pH 8.0).
  Proteolytic Activity: < 10^-3 U/mg protein (Azocoll, 25°C, 24 h, pH 8.0).
• Protein Sequence: MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.
• Source: E. coli

Target Info

• Gene Symbol: Streptavidin
• Alias Symbols: Streptavidin, Streptavidin Recombinant
• Protein Name: Streptavidin
• Description of Target: Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14). The complexes are also extremely stable over a wide range of temperature and pH.
• Uniprot ID: P22629
• Protein Size (# AA): Recombinant
• Molecular Weight: 52 kDa