Recombinant SARS-CoV-2 Spike Glycoprotein (OPCA335982)

Catalog No: OPCA335982

Product Info

• Predicted Species Reactivity: SARS-CoV-2
• Product Format: Lyophilized powder
• Application: SDS-PAGE
• Additional Information: Biological Activity:
  1. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ug/ml can bind human ACE2 , the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml.
  2. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ug/ml can bind SARS-CoV-2-S Antibody , the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml.
  Biological Activity: 1. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ug/ml can bind human ACE2 , the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ug/ml can bind SARS-CoV-2-S Antibody , the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml.
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Biological Activity: 1. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ug/ml can bind human ACE2 , the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 ug/ml can bind SARS-CoV-2-S Antibody , the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml.
• Protein Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
• Storage Buffer: Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Mammalian cell
• Protein Range: 16-685 aa
• Tag: N-terminal 10xHis-tagged and C-terminal Flag-tagged

Target Info

• Gene Symbol: S
• Protein Name: Spike glycoprotein
• Uniprot ID: P0DTC2
• Protein Size (# AA): 16-685 aa
• Molecular Weight: 79.6 kDa