Catalog No: OPCA335978
Price: $0.00
SKU
OPCA335978
Availability: Domestic: within 4-6 weeks delivery | International: 4-6 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Recombinant SARS-CoV-2 Spike Glycoprotein (OPCA335978)

Datasheets/ManualsPrintable datasheet for OPCA335978
Product Info
Predicted Species ReactivitySARS-CoV-2
Product FormatLyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution and StorageBriefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
PurityGreater than 85% as determined by SDS-PAGE.
Protein SequencePartial Length (16-685aa): VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
SourceBaculovirus
TagTag type will be determined during the manufacturing process
Gene SymbolS,S1
Alias Symbolsspike glycoprotein
NCBI Gene Id43740568
Protein NameSpike glycoprotein
Swissprot IdP0DTC2
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express S,S1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express S,S1.
Write Your Own Review
You're reviewing:Recombinant SARS-CoV-2 Spike Glycoprotein (OPCA335978)
Your Rating