$0.00
In Stock
SKU
OPCA01216
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Recombinant Mouse Calreticulin (OPCA01216)

Catalog#: OPCA01216
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Mouse
Additional Information Tag information : His tag
Reconstitution and Storage Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity >90% (SDS-PAGE)
Peptide Sequence DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL
Source Yeast
Datasheets/Manuals Printable datasheet for Recombinant Mouse Calreticulin (OPCA01216)OPCA01216
Gene Symbol Calr
NCBI Gene Id 12317
Protein Name Calreticulin
Description of Target Recombinant Mouse Calreticulin
Swissprot Id P14211
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Calr.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Calr.
Write Your Own Review
You're reviewing:Recombinant Mouse Calreticulin (OPCA01216)
Your Rating
We found other products you might like!