Search Antibody, Protein, and ELISA Kit Solutions

Recombinant Mouse Calreticulin (OPCA01216)

* Required Fields

$0.00
In Stock
Request Bulk Order Quote

Predicted Species Reactivity:
Mouse
Additional Information:
Tag information : His tag
Reconstitution and Storage:
Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Symbol:
Calr
NCBI Gene Id:
12317
Protein Name:
Calreticulin
Description of Target:
Recombinant Mouse Calreticulin
Swissprot Id:
P14211
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Calr.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Calr.
Purity:
>90% (SDS-PAGE)
Peptide Sequence:
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL
Source:
Yeast
Datasheets/Manuals:
Printable datasheet for Recombinant Mouse Calreticulin (OPCA01216)OPCA01216

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...