$0.00
In stock
SKU
OPCA01437
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Recombinant Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IgG receptor FcRn large subunit p51 (OPCA01437)

Catalog#: OPCA01437
Domestic: within 4-6 weeks delivery International: 4-6 weeks
More Information
Product Format Liquid
Application ELISA, WB, SDS-PAGE
Additional Information Product Info: His tagged
Tag Info: His-SUMO-tag
Sequence Info: Extracellular domain
:: Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
:: Expression Region: 24-297aa
Reconstitution and Storage Store at -20C, for extended storage, conserve at -20C or -80C.
Predicted Homology Based on Immunogen Sequence Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Purity >90%
Storage Buffer Tris-based buffer, 50% glycerol
Source E.coli
Datasheets/Manuals Printable datasheet for (OPCA01437)OPCA01437
Gene Symbol FCGRT
Alias Symbols FCRN
Protein Name Recommended name: IgG receptor FcRn large subunit p51 Short name= FcRn Alternative name(s): IgG Fc fragment receptor transporter alpha chain Neonatal Fc receptor
Description of Target Recombinant Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IgG receptor FcRn large subunit p51
Swissprot Id Q8SPV9
Protein Size (# AA) AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQ
Molecular Weight 46.4kD
Write Your Own Review
You're reviewing:Recombinant Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IgG receptor FcRn large subunit p51 (OPCA01437)
Your Rating