Search Antibody, Protein, and ELISA Kit Solutions

Recombinant Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IgG receptor FcRn large subunit p51 (OPCA01437)

* Required Fields

$0.00
In Stock
Request Bulk Order Quote

Gene Symbol:
FCGRT
Alias Symbols:
FCRN
Swissprot Id:
Q8SPV9
Protein Name:
Recommended name: IgG receptor FcRn large subunit p51 Short name= FcRn Alternative name(s): IgG Fc fragment receptor transporter alpha chain Neonatal Fc receptor
Description of Target:
Recombinant Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) IgG receptor FcRn large subunit p51
Protein Size (# AA):
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQ
Molecular Weight:
46.4kD
Product Format:
Liquid
Predicted Homology Based on Immunogen Sequence:
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Purity:
>90%
Storage Buffer:
Tris-based buffer, 50% glycerol
Source:
E.coli
Application:
ELISA, WB, SDS-PAGE
Additional Information:
Product Info: His tagged
Tag Info: His-SUMO-tag
Sequence Info: Extracellular domain
:::
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
:::
Expression Region: 24-297aa
Reconstitution and Storage:
Store at -20C, for extended storage, conserve at -20C or -80C.
Datasheets/Manuals:
Printable datasheet for (OPCA01437)OPCA01437

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...