Search Antibody, Protein, and ELISA Kit Solutions

Recombinant human Proto-oncogene c-Rel Protein (OPCA01146)

* Required Fields

$0.00
In Stock
Request Bulk Order Quote

Gene Symbol:
Rel
Swissprot Id:
P15307
Protein Name:
Proto-oncogene c-Rel
Description of Target:
Recombinant human Proto-oncogene c-Rel protein
Product Format:
Liquid. 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol
Purity:
>90% (SDS-PAGE)
Peptide Sequence:
SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF
Protein Sequence:
Expression Region: 3-616aa
Source:
E.coli
Tag:
N-terminal 6xHis-tagged
Reconstitution and Storage:
Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Datasheets/Manuals:
Printable datasheet for Recombinant human Proto-oncogene c-Rel protein (OPCA01146)OPCA01146

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...