$0.00
In Stock
SKU
OPCA01146
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Recombinant human Proto-oncogene c-Rel Protein (OPCA01146)

Catalog#: OPCA01146
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Product Format Liquid. 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol
Reconstitution and Storage Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity >90% (SDS-PAGE)
Peptide Sequence SGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEF
Protein Sequence Expression Region: 3-616aa
Source E.coli
Tag N-terminal 6xHis-tagged
Datasheets/Manuals Printable datasheet for Recombinant human Proto-oncogene c-Rel protein (OPCA01146)OPCA01146
Gene Symbol Rel
Protein Name Proto-oncogene c-Rel
Description of Target Recombinant human Proto-oncogene c-Rel protein
Swissprot Id P15307
Write Your Own Review
You're reviewing:Recombinant human Proto-oncogene c-Rel Protein (OPCA01146)
Your Rating