$0.00
In stock
SKU
OPCA00283
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Recombinant Gadus morhua subsp. callarias Parvalbumin beta (OPCA00283)

Catalog#: OPCA00283
Domestic: within 4-6 weeks delivery International: 4-6 weeks
More Information
Additional Information Tag information : His tag
Reconstitution and Storage Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity >90% (SDS-PAGE)
Peptide Sequence AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG
Source E.coli
Datasheets/Manuals Printable datasheet for Recombinant Gadus morhua subsp. callarias Parvalbumin beta (OPCA00283)OPCA00283
Description of Target Recombinant Gadus morhua subsp. callarias Parvalbumin beta
Write Your Own Review
You're reviewing:Recombinant Gadus morhua subsp. callarias Parvalbumin beta (OPCA00283)
Your Rating