Search Antibody, Protein, and ELISA Kit Solutions

Recombinant Gadus morhua subsp. callarias Parvalbumin beta (OPCA00283)

* Required Fields

$0.00
In Stock
Request Bulk Order Quote

Description of Target:
Recombinant Gadus morhua subsp. callarias Parvalbumin beta
Purity:
>90% (SDS-PAGE)
Peptide Sequence:
AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG
Source:
E.coli
Additional Information:
Tag information : His tag
Reconstitution and Storage:
Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Datasheets/Manuals:
Printable datasheet for Recombinant Gadus morhua subsp. callarias Parvalbumin beta (OPCA00283)OPCA00283

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...