Catalog No: ARP52667_P050
Price: $0.00
SKU
ARP52667_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RDHE2 Antibody - middle region (ARP52667_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-SDR16C5 (ARP52667_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RDHE2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 92%; Human: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT
Concentration0.5 mg/ml
Blocking PeptideFor anti-SDR16C5 (ARP52667_P050) antibody is Catalog # AAP52667 (Previous Catalog # AAPY03747)
ReferenceMatsuzaka,Y., (2004) Mamm. Genome 15 (8), 668-675
Gene SymbolSDR16C5
Gene Full NameShort chain dehydrogenase/reductase family 16C, member 5
Alias SymbolsRDH#2, RDHE2, EPHD-2, RDH-E2, retSDR2
NCBI Gene Id195814
Protein NameEpidermal retinol dehydrogenase 2
Description of TargetThe specific function of RDHE2 is not yet known.RDHE2 belongs to a family of short-chain alcohol dehydrogenases/reductases that catalyze the first and rate-limiting step that generates retinaldehyde from retinol (Matsuzaka et al., 2002 [PubMed 12372410]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-454 AB083038.1 1-454 455-1307 AK095159.1 549-1401 1308-2860 BC037219.1 749-2301 2861-3039 BC037219.1 2303-2481
Uniprot IDQ8N3Y7
Protein Accession #NP_620419
Nucleotide Accession #NM_138969
Protein Size (# AA)309
Molecular Weight34kDa
Protein InteractionsNLK; UBC; EXTL1;
  1. What is the species homology for "RDHE2 Antibody - middle region (ARP52667_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Guinea Pig".

  2. How long will it take to receive "RDHE2 Antibody - middle region (ARP52667_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RDHE2 Antibody - middle region (ARP52667_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RDHE2 Antibody - middle region (ARP52667_P050)"?

    This target may also be called "RDH#2, RDHE2, EPHD-2, RDH-E2, retSDR2" in publications.

  5. What is the shipping cost for "RDHE2 Antibody - middle region (ARP52667_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RDHE2 Antibody - middle region (ARP52667_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RDHE2 Antibody - middle region (ARP52667_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RDHE2 Antibody - middle region (ARP52667_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SDR16C5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SDR16C5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SDR16C5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SDR16C5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SDR16C5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SDR16C5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RDHE2 Antibody - middle region (ARP52667_P050)
Your Rating