RCVRN Recombinant Protein (Human) (OPCA04183)

Catalog No: OPCA04183

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
• Protein Sequence: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 2-200 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Isolation of human retinal genes: recoverin cDNA and gene.Murakami A., Yajima T., Inana G.Biochem. Biophys. Res. Commun.187:234-244(1992)

Target Info

• Gene Symbol: RCVRN
• Gene Full Name: recoverin
• Alias Symbols: cancer associated retinopathy antigen;cancer-associated retinopathy protein;RCV1;recoverin.
• NCBI Gene Id: 5957
• Protein Name: Recoverin
• Description of Target: Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
• Uniprot ID: P35243
• Protein Accession #: NP_002894
• Nucleotide Accession #: NM_002903
• Protein Size (# AA): Recombinant
• Molecular Weight: 25 kDa