- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-RCVRN (OAAN01784) |
---|
Predicted Species Reactivity | Human, Mouse, Rat |
---|---|
Product Format | Liquid. PBS, pH 7.3, with 0.02% sodium azide and 50% glycerol. |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IHC, IF |
:: | Positive Samples: Mouse eye, rat eye |
Reconstitution and Storage | Store at -20°C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RCVRN (NP_002894.1). |
Purification | Affinity purified against immunogen |
Peptide Sequence | MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
Application Info | WB 1:500~2000 IHC 1:50~200 IF 1:10~100 |
Gene Symbol | RCVRN |
---|---|
Gene Full Name | recoverin |
Alias Symbols | RCV1 |
NCBI Gene Id | 5957 |
Protein Name | Recoverin |
Description of Target | This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. |
Uniprot ID | P35243 |
Protein Accession # | NP_002894.1 |
Nucleotide Accession # | NM_002903.2 |
Molecular Weight | 23 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RCVRN Antibody (OAAN01784)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "RCVRN Antibody (OAAN01784)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "RCVRN Antibody (OAAN01784)" provided in?
This item is provided in "Liquid. PBS, pH 7.3, with 0.02% sodium azide and 50% glycerol.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RCVRN Antibody (OAAN01784)"?
This target may also be called "RCV1" in publications.
-
What is the shipping cost for "RCVRN Antibody (OAAN01784)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RCVRN Antibody (OAAN01784)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RCVRN Antibody (OAAN01784)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "23 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RCVRN Antibody (OAAN01784)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RCVRN"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RCVRN"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RCVRN"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RCVRN"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RCVRN"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RCVRN"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.