RCV1 Antibody - C-terminal region (ARP38196_P050)

Catalog No: ARP38196_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-RCV1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RCV1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 79%; Horse: 86%; Human: 100%; Pig: 75%; Rabbit: 79%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: KMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RCVRN (ARP38196_P050) antibody is Catalog # AAP38196 (Previous Catalog # AAPP20372)
• Reference: Miyagawa,Y., et al., (2003) Biochem. Biophys. Res. Commun. 300 (3), 669-673

Target Info

• Gene Symbol: RCVRN
• Gene Full Name: Recoverin
• Alias Symbols: RCV1
• NCBI Gene Id: 5957
• Protein Name: Recoverin EMBL AAP88840.1
• Description of Target: RCV1 is a member of the recoverin family of neuronal calcium sensors. RCV1 contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.The protein encoded by this gene contains four calcium-binding EF-hand domains and belongs to the recoverin family of neuronal calcium sensors. Recoverin may prolong the termination of the phototransduction cascade by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy; an autoimmune disease of the retina caused by a tumor in another tissue.
• Uniprot ID: Q53XL0
• Protein Accession #: NP_002894
• Nucleotide Accession #: NM_002903
• Protein Size (# AA): 200
• Molecular Weight: 23kDa
• Protein Interactions: GIT2; TGFBR2; SMAD3; IL15RA; TOP1; PQBP1; CAV1; GRK5; GRK6; GRK1; ADRBK1;