Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP34346_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34346_P050-FITC Conjugated

ARP34346_P050-HRP Conjugated

ARP34346_P050-Biotin Conjugated

RCOR1 Antibody - middle region (ARP34346_P050)

Catalog#: ARP34346_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RCOR1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 86%; Rat: 79%
Complete computational species homology data Anti-RCOR1 (ARP34346_P050)
Peptide Sequence Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-RCOR1 (ARP34346_P050) antibody is Catalog # AAP34346 (Previous Catalog # AAPP05696)
Datasheets/Manuals Printable datasheet for anti-RCOR1 (ARP34346_P050) antibody
Sample Type Confirmation

RCOR1 is supported by BioGPS gene expression data to be expressed in HT1080

Target Reference Abuhatzira,L., (2007) Epigenetics 2 (4), 214-222
Gene Symbol RCOR1
Official Gene Full Name REST corepressor 1
Alias Symbols COREST, KIAA0071, RCOR
NCBI Gene Id 23186
Protein Name REST corepressor 1
Description of Target RCOR1 is a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q9UKL0
Protein Accession # NP_055971
Nucleotide Accession # NM_015156
Protein Size (# AA) 482
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RCOR1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RCOR1.
Protein Interactions HDAC1; UBC; KDM1A; HDAC2; HDAC3; NPM1; MTA3; TP53BP1; NR2C1; TCF3; HMG20B; RCOR1; SNAI1; SUMO2; Dynll1; HIST3H3; TAL1; GFI1; GFI1B; MED28; OBFC1; SUB1; MED12; TRIP4; BCL3; ESCO2; SERPINH1; ZNF217; EMD; CTBP1; RL2; NR2E1; REST; HIST1H3A; SMARCE1; SMARCC2;
  1. What is the species homology for "RCOR1 Antibody - middle region (ARP34346_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "RCOR1 Antibody - middle region (ARP34346_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RCOR1 Antibody - middle region (ARP34346_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RCOR1 Antibody - middle region (ARP34346_P050)"?

    This target may also be called "COREST, KIAA0071, RCOR" in publications.

  5. What is the shipping cost for "RCOR1 Antibody - middle region (ARP34346_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RCOR1 Antibody - middle region (ARP34346_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RCOR1 Antibody - middle region (ARP34346_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RCOR1 Antibody - middle region (ARP34346_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "RCOR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RCOR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RCOR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RCOR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RCOR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RCOR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RCOR1 Antibody - middle region (ARP34346_P050)
Your Rating
We found other products you might like!