Search Antibody, Protein, and ELISA Kit Solutions

RCOR1 Antibody - middle region (ARP34346_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34346_P050-FITC Conjugated

ARP34346_P050-HRP Conjugated

ARP34346_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
RCOR1
Official Gene Full Name:
REST corepressor 1
NCBI Gene Id:
23186
Protein Name:
REST corepressor 1
Swissprot Id:
Q9UKL0
Protein Accession #:
NP_055971
Nucleotide Accession #:
NM_015156
Alias Symbols:
COREST, KIAA0071, RCOR
Description of Target:
RCOR1 is a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
482
Molecular Weight:
53kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RCOR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RCOR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RCOR1
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 86%; Rat: 79%
Complete computational species homology data:
Anti-RCOR1 (ARP34346_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HDAC1; UBC; KDM1A; HDAC2; HDAC3; NPM1; MTA3; TP53BP1; NR2C1; TCF3; HMG20B; RCOR1; SNAI1; SUMO2; Dynll1; HIST3H3; TAL1; GFI1; GFI1B; MED28; OBFC1; SUB1; MED12; TRIP4; BCL3; ESCO2; SERPINH1; ZNF217; EMD; CTBP1; RL2; NR2E1; REST; HIST1H3A; SMARCE1; SMARCC2;
Blocking Peptide:
For anti-RCOR1 (ARP34346_P050) antibody is Catalog # AAP34346 (Previous Catalog # AAPP05696)
Datasheets/Manuals:
Printable datasheet for anti-RCOR1 (ARP34346_P050) antibody
Sample Type Confirmation:

RCOR1 is supported by BioGPS gene expression data to be expressed in HT1080

Target Reference:
Abuhatzira,L., (2007) Epigenetics 2 (4), 214-222

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...