RCOR1 Antibody - C-terminal region (ARP39179_P050)

Size:100 ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Human Jurkat

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RCOR1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Mouse: 79%
• Complete computational species homology data: Anti-RCOR1 (ARP39179_P050)
• Peptide Sequence: Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-RCOR1 (ARP39179_P050) antibody is Catalog # AAP39179 (Previous Catalog # AAPP21284)
• Datasheets/Manuals: Printable datasheet for anti-RCOR1 (ARP39179_P050) antibody
• Sample Type Confirmation:

  RCOR1 is supported by BioGPS gene expression data to be expressed in Jurkat

• Target Reference: Battaglioli,E., (2002) J. Biol. Chem. 277 (43), 41038-41045

Target Info

• Gene Symbol: RCOR1
• Official Gene Full Name: REST corepressor 1
• Alias Symbols: RCOR, COREST
• NCBI Gene Id: 23186
• Protein Name: REST corepressor 1
• Description of Target: RCOR1 is a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.[supplied by OMIM].
• Swissprot Id: Q9UKL0
• Protein Accession #: NP_055971
• Nucleotide Accession #: NM_015156
• Protein Size (# AA): 482
• Molecular Weight: 53kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express RCOR1.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express RCOR1.
• Protein Interactions: HDAC1; UBC; KDM1A; HDAC2; HDAC3; NPM1; MTA3; TP53BP1; NR2C1; TCF3; HMG20B; RCOR1; SNAI1; SUMO2; Dynll1; HIST3H3; TAL1; GFI1; GFI1B; MED28; OBFC1; SUB1; MED12; TRIP4; BCL3; ESCO2; SERPINH1; ZNF217; EMD; CTBP1; RL2; NR2E1; REST; HIST1H3A; SMARCE1; SMARCC2;