Search Antibody, Protein, and ELISA Kit Solutions

RCOR1 Antibody - C-terminal region (ARP39179_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39179_P050-FITC Conjugated

ARP39179_P050-HRP Conjugated

ARP39179_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
RCOR1
Official Gene Full Name:
REST corepressor 1
NCBI Gene Id:
23186
Protein Name:
REST corepressor 1
Swissprot Id:
Q9UKL0
Protein Accession #:
NP_055971
Nucleotide Accession #:
NM_015156
Alias Symbols:
RCOR, COREST
Description of Target:
RCOR1 is a functional corepressor required for regulation of neural-specific gene expression.The RCOR gene encodes a functional corepressor required for regulation of neural-specific gene expression.[supplied by OMIM].
Protein Size (# AA):
482
Molecular Weight:
53kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RCOR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RCOR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human RCOR1
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Mouse: 79%
Complete computational species homology data:
Anti-RCOR1 (ARP39179_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HDAC1; UBC; KDM1A; HDAC2; HDAC3; NPM1; MTA3; TP53BP1; NR2C1; TCF3; HMG20B; RCOR1; SNAI1; SUMO2; Dynll1; HIST3H3; TAL1; GFI1; GFI1B; MED28; OBFC1; SUB1; MED12; TRIP4; BCL3; ESCO2; SERPINH1; ZNF217; EMD; CTBP1; RL2; NR2E1; REST; HIST1H3A; SMARCE1; SMARCC2;
Blocking Peptide:
For anti-RCOR1 (ARP39179_P050) antibody is Catalog # AAP39179 (Previous Catalog # AAPP21284)
Datasheets/Manuals:
Printable datasheet for anti-RCOR1 (ARP39179_P050) antibody
Sample Type Confirmation:

RCOR1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Battaglioli,E., (2002) J. Biol. Chem. 277 (43), 41038-41045

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...