Search Antibody, Protein, and ELISA Kit Solutions

RCN2 Antibody - middle region (ARP78509_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
reticulocalbin 2
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
E6BP, ERC55, ERC-55, TCBP49,
Replacement Item:
This antibody may replace item sc-293069 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. This gene maps to the same region as type 4 Bardet-Biedl syndrome, suggesting a possible causative role for this gene in the disorder. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
35 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RCN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RCN2.
The immunogen is a synthetic peptide directed towards the middle region of human RCN2
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: RVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RCN2 (ARP78509_P050) antibody is Catalog # AAP78509
Printable datasheet for anti-RCN2 (ARP78509_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...