Search Antibody, Protein, and ELISA Kit Solutions

RBPJL Antibody - N-terminal region (ARP39071_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP39071_P050-FITC Conjugated

ARP39071_P050-HRP Conjugated

ARP39071_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
recombination signal binding protein for immunoglobulin kappa J region-like
NCBI Gene Id:
Protein Name:
Recombining binding protein suppressor of hairless-like protein
Swissprot Id:
Replacement Item:
This antibody may replace item sc-152762 from Santa Cruz Biotechnology.
Description of Target:
RBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein. In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RBPJL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RBPJL.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBPJL
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-RBPJL (ARP39071_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTT
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RBPJL (ARP39071_P050) antibody is Catalog # AAP39071
Printable datasheet for anti-RBPJL (ARP39071_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...