SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP89388_P050
Price: $0.00
SKU
ARP89388_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RBPJ (ARP89388_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse RBPJ
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN
Concentration0.5 mg/ml
Blocking PeptideFor anti-RBPJ (ARP89388_P050) antibody is Catalog # AAP89388
Gene SymbolRBPJ
Gene Full Namerecombination signal binding protein for immunoglobulin kappa J region
Alias SymbolsIgk, RBP, CBF1, Igkj, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa
NCBI Gene Id19664
Protein Namerecombining binding protein suppressor of hairless
Description of TargetTranscriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes. Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins, respectively. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. Binds specifically to methylated DNA. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen) (By similarity). Negatively regulates the phagocyte oxidative burst in response to bacterial infection by repressing transcription of NADPH oxidase subunits.
Uniprot IDP31266-2
Protein Accession #NP_001074396.1
Nucleotide Accession #NM_001080927.2
Protein Size (# AA)487
Molecular Weight53 kDa
  1. What is the species homology for "RBPJ Antibody - middle region (ARP89388_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "RBPJ Antibody - middle region (ARP89388_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "RBPJ Antibody - middle region (ARP89388_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RBPJ Antibody - middle region (ARP89388_P050)"?

    This target may also be called "Igk, RBP, CBF1, Igkj, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa" in publications.

  5. What is the shipping cost for "RBPJ Antibody - middle region (ARP89388_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RBPJ Antibody - middle region (ARP89388_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RBPJ Antibody - middle region (ARP89388_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RBPJ Antibody - middle region (ARP89388_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RBPJ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RBPJ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RBPJ"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RBPJ"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RBPJ"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RBPJ"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RBPJ Antibody - middle region (ARP89388_P050)
Your Rating