RBP7 Antibody - middle region (ARP52467_P050)

Catalog No: ARP52467_P050

Host: Rabbit
Target Name: RBP7
Sample Tissue: Stomach Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBP7
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 86%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: TIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RBP7 (ARP52467_P050) antibody is Catalog # AAP52467

Target Info

• Gene Symbol: RBP7
• Gene Full Name: retinol binding protein 7
• Alias Symbols: CRBP4, CRABP4, CRBPIV
• NCBI Gene Id: 116362
• Protein Name: retinoid-binding protein 7
• Description of Target: Due to its chemical instability and low solubility in aqueous solution, vitamin A requires cellular retinol-binding proteins (CRBPs), such as RBP7, for stability, internalization, intercellular transfer, homeostasis, and metabolism.[supplied by OMIM, May 2004]
• Uniprot ID: Q96R05
• Protein Accession #: NP_443192
• Nucleotide Accession #: NM_052960.2
• Protein Size (# AA): 134
• Molecular Weight: 14 kDa