Catalog No: ARP63707_P050
Price: $0.00
SKU
ARP63707_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
View product citations for antibody ARP63707_P050 on CiteAb
Datasheets/ManualsPrintable datasheet for anti-RBP2 (ARP63707_P050) antibody
Product Info
Publications

Lee, J.-H., You, J., Dobrota, E. & Skalnik, D. G. Identification and characterization of a novel human PP1 phosphatase complex. J. Biol. Chem. 285, 24466-76 (2010). 20516061

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: DVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWI
Concentration0.5 mg/ml
Blocking PeptideFor anti-RBP2 (ARP63707_P050) antibody is Catalog # AAP63707
Gene SymbolRBP2
Gene Full NameRetinol binding protein 2, cellular
Alias SymbolsCRBP2, RBPC2, CRBPII, CRABP-II
NCBI Gene Id5948
Protein NameRetinol-binding protein 2
Description of TargetRBP2 is an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. RBP2 may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
Uniprot IDP50120
Protein Accession #NP_004155
Nucleotide Accession #NM_004164
Protein Size (# AA)134
Molecular Weight15kDa
Protein InteractionsRB1; MORF4L1; MORF4L2; LRAT;
  1. What is the species homology for "RBP2 Antibody - middle region (ARP63707_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "RBP2 Antibody - middle region (ARP63707_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RBP2 Antibody - middle region (ARP63707_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RBP2 Antibody - middle region (ARP63707_P050)"?

    This target may also be called "CRBP2, RBPC2, CRBPII, CRABP-II" in publications.

  5. What is the shipping cost for "RBP2 Antibody - middle region (ARP63707_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RBP2 Antibody - middle region (ARP63707_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RBP2 Antibody - middle region (ARP63707_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RBP2 Antibody - middle region (ARP63707_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RBP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RBP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RBP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RBP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RBP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RBP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RBP2 Antibody - middle region (ARP63707_P050)
Your Rating