- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-RBMS1 (ARP40428_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RBMS1 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTT |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-RBMS1 (ARP40428_T100) antibody is Catalog # AAP40428 (Previous Catalog # AAPS03007) |
Sample Type Confirmation | RBMS1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Reference | Niki,T., (2000) FEBS Lett. 475 (3), 209-212 |
Gene Symbol | RBMS1 |
---|---|
Gene Full Name | RNA binding motif, single stranded interacting protein 1 |
Alias Symbols | YC1, MSSP, SCR2, HCC-4, MSSP-1, MSSP-2, MSSP-3, C2orf12 |
NCBI Gene Id | 5937 |
Protein Name | RNA-binding motif, single-stranded-interacting protein 1 |
Description of Target | RBMS1 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Multiple transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. Several of these were isolated by virtue of their binding to either strand of an upstream element of c-myc (MSSPs), or by phenotypic complementation of cdc2 and cdc13 mutants of yeast (scr2), or as a potential human repressor of HIV-1 and ILR-2 alpha promoter transcription (YC1). A pseudogene for this locus is found on chromosome 12. |
Uniprot ID | P29558-2 |
Protein Accession # | NP_002888 |
Nucleotide Accession # | NM_002897 |
Protein Size (# AA) | 403 |
Molecular Weight | 44kDa |
Protein Interactions | TFCP2; UBC; MRPL53; MRRF; SARNP; NABP2; SRPRB; SUGP1; SBDS; UBQLN1; TIMM44; HRSP12; PPIF; PQBP1; ZC3H11A; SNX3; STX7; UBE2I; SNRPC; SCP2; RRBP1; RPS19; RPL38; RFX5; PPIB; NDUFA7; DNM2; GRK5; POLA1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RBMS1 Antibody - middle region (ARP40428_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "RBMS1 Antibody - middle region (ARP40428_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "RBMS1 Antibody - middle region (ARP40428_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RBMS1 Antibody - middle region (ARP40428_T100)"?
This target may also be called "YC1, MSSP, SCR2, HCC-4, MSSP-1, MSSP-2, MSSP-3, C2orf12" in publications.
-
What is the shipping cost for "RBMS1 Antibody - middle region (ARP40428_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RBMS1 Antibody - middle region (ARP40428_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RBMS1 Antibody - middle region (ARP40428_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "44kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RBMS1 Antibody - middle region (ARP40428_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RBMS1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RBMS1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RBMS1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RBMS1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RBMS1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RBMS1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.