Search Antibody, Protein, and ELISA Kit Solutions

RBM9 antibody - middle region (ARP40764_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40764_P050-FITC Conjugated

ARP40764_P050-HRP Conjugated

ARP40764_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
RBFOX2
NCBI Gene Id:
23543
Official Gene Full Name:
RNA binding protein, fox-1 homolog (C. elegans) 2
Protein Name:
RNA binding protein fox-1 homolog 2
Swissprot Id:
O43251-9
Protein Accession #:
NP_055124
Nucleotide Accession #:
NM_014309
Alias Symbols:
Fox-2, HNRBP2, HRNBP2, RTA, dJ106I20.3, fxh, FOX2, RBM9
Description of Target:
RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
Protein Size (# AA):
367
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RBM9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RBM9.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RBM9
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 75%; Goat: 76%; Horse: 85%; Human: 100%; Mouse: 93%; Yeast: 85%
Complete computational species homology data:
Anti-RBM9 (ARP40764_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAPK1IP1L; NAF1; C1orf94; BOLL; VAC14; DAZAP2; MAGED1; RNF8; ATXN1; PSMA3; HNRNPF; DAB1; CAMK2B; RPA3; RPA2; RPA1; BMI1; ELAVL1; DDX5; RBM42; RBM22; RBM23; APH1A; RBFOX2; U2AF2; KHDRBS1; SF3A1; PSMF1; QKI; SNRPC; SMN1; PTBP1; HNRNPK; HNRNPH2; VCP; ATXN1L;
Blocking Peptide:
For anti-RBFOX2 (ARP40764_P050) antibody is Catalog # AAP40764 (Previous Catalog # AAPY01016)
Datasheets/Manuals:
Printable datasheet for anti-RBFOX2 (ARP40764_P050) antibody
Sample Type Confirmation:

RBFOX2 is supported by BioGPS gene expression data to be expressed in NCIH226

Target Reference:
Yang,G., (2008) Blood 111 (1), 392-401

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...