Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OPCA58425
Price: $0.00
SKU
OPCA58425
Availability: Please Inquire. Lead time depends on expression system.
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Protein on Demand™ RBCL Recombinant Protein (Poke milkweed) (OPCA58425)

Datasheets/ManualsPrintable datasheet for OPCA58425
Product Info
Predicted Species ReactivityPoke milkweed
Product FormatLyophilized powder
ApplicationWB, ELISA
Additional InformationFor Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and StorageBriefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
PurityGreater than 85% as determined by SDS-PAGE.
Protein SequenceDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEXVPGEEDQFIAYVAYPLDLFEEGSVTNMLTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLRCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIFKSQAETGEIKGHYLNATAGTCEEMYKRAIFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHXXMHAVIDRQKNHGMHFRVLAKALRMSGGDHIYAGTVVGKLEGERDITLGFVDLLRDDFVEKDRSRGIYFTQDWVSLPGVLAVASGGIHVXHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAVEGNEIIREASKWSPELAAACEVWKEIRFNFKAVDTL
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
TagThis protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Gene SymbolRBCL
Uniprot IDP36480
Protein Size (# AA)441
Write Your Own Review
You're reviewing:Protein on Demand™ RBCL Recombinant Protein (Poke milkweed) (OPCA58425)
Your Rating