Rb1 Antibody - middle region : Biotin (ARP33211_P050-Biotin)

Catalog No: ARP33211_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of MOUSE Rb1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Rb1 (ARP33211_P050-Biotin) antibody is Catalog # AAP33211

Target Info

• Gene Symbol: Rb1
• Gene Full Name: retinoblastoma 1
• Alias Symbols: R, p, Rb, Rb-, pRb, Rb-1, pp105, p110-RB1
• NCBI Gene Id: 19645
• Protein Name: Retinoblastoma-associated protein
• Description of Target: SLC11A1 is key regulator of entry into cell division that acts as a tumor suppressor. It promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C. It acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. It is directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. It recruits and targets histone methyltransferases SUV39H1, SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. It controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. It mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex By similarity.
• Uniprot ID: P13405
• Protein Accession #: NP_033055
• Nucleotide Accession #: NM_009029
• Protein Size (# AA): 921
• Molecular Weight: 101kDa
• Protein Interactions: Prkcb; Pax2; Prmt2; CDK4; CDK2; Mrfap1; Morf4l1; Jarid2; Cebpd; Cebpb; Cebpa; Neurod1; Cdk6; Rbak; PPP1CA; Cdk9; Ccnd1; Psmd10; Ppp1cc; CSNK2A1; Cdkn1b; E2f1; Suv420h2; Suv420h1; Hdac1; Ubtf; Hmga2; Id2; Hmga1; Runx2; E2f2; ZFPM1; GATA1; TP53BP1; Smarca4;