ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP33211_P050
Price: $0.00
SKU
ARP33211_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Rb1 (ARP33211_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of MOUSE Rb1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: TETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELE
Concentration0.5 mg/ml
Blocking PeptideFor anti-Rb1 (ARP33211_P050) antibody is Catalog # AAP33211
Gene SymbolRb1
Gene Full Nameretinoblastoma 1
Alias SymbolsR, p, Rb, Rb-, pRb, Rb-1, pp105, p110-RB1
NCBI Gene Id19645
Protein NameRetinoblastoma-associated protein
Description of TargetSLC11A1 is key regulator of entry into cell division that acts as a tumor suppressor. It promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C. It acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. It is directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. It recruits and targets histone methyltransferases SUV39H1, SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. It controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. It mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex By similarity.
Uniprot IDP13405
Protein Accession #NP_033055
Nucleotide Accession #NM_009029
Protein Size (# AA)921
Molecular Weight101kDa
Protein InteractionsPrkcb; Pax2; Prmt2; CDK4; CDK2; Mrfap1; Morf4l1; Jarid2; Cebpd; Cebpb; Cebpa; Neurod1; Cdk6; Rbak; PPP1CA; Cdk9; Ccnd1; Psmd10; Ppp1cc; CSNK2A1; Cdkn1b; E2f1; Suv420h2; Suv420h1; Hdac1; Ubtf; Hmga2; Id2; Hmga1; Runx2; E2f2; ZFPM1; GATA1; TP53BP1; Smarca4;
  1. What is the species homology for "Rb1 Antibody - middle region (ARP33211_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "Rb1 Antibody - middle region (ARP33211_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Rb1 Antibody - middle region (ARP33211_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Rb1 Antibody - middle region (ARP33211_P050)"?

    This target may also be called "R, p, Rb, Rb-, pRb, Rb-1, pp105, p110-RB1" in publications.

  5. What is the shipping cost for "Rb1 Antibody - middle region (ARP33211_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Rb1 Antibody - middle region (ARP33211_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Rb1 Antibody - middle region (ARP33211_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "101kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Rb1 Antibody - middle region (ARP33211_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Rb1 Antibody - middle region (ARP33211_P050)
Your Rating
We found other products you might like!