Search Antibody, Protein, and ELISA Kit Solutions

RASSF4 Antibody - middle region (ARP85599_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
RASSF4
Official Gene Full Name:
Ras association domain family member 4
NCBI Gene Id:
83937
Protein Name:
ras association domain-containing protein 4
Swissprot Id:
P50749
Protein Accession #:
NP_114412.2
Nucleotide Accession #:
NM_032023.3
Alias Symbols:
AD037
Description of Target:
The function of this gene has not yet been determined but may involve a role in tumor suppression. Alternative splicing of this gene results in several transcript variants; however, most of the variants have not been fully described.
Protein Size (# AA):
326
Molecular Weight:
35 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RASSF4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RASSF4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle terminal region of Human RASSF4
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: AEEAPQLMRTKSDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RASSF4 (ARP85599_P050) antibody is Catalog # AAP85599
Datasheets/Manuals:
Printable datasheet for anti-RASSF4 (ARP85599_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...