RASSF4 Antibody - middle region (ARP85599_P050)

Catalog No: ARP85599_P050

Host: Rabbit
Target Name: RASSF4
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of Human RASSF4
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: AEEAPQLMRTKSDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RASSF4 (ARP85599_P050) antibody is Catalog # AAP85599

Target Info

• Gene Symbol: RASSF4
• Gene Full Name: Ras association domain family member 4
• Alias Symbols: AD037
• NCBI Gene Id: 83937
• Protein Name: ras association domain-containing protein 4
• Description of Target: The function of this gene has not yet been determined but may involve a role in tumor suppression. Alternative splicing of this gene results in several transcript variants; however, most of the variants have not been fully described.
• Uniprot ID: P50749
• Protein Accession #: NP_114412.2
• Nucleotide Accession #: NM_032023.3
• Protein Size (# AA): 326
• Molecular Weight: 35 kDa