Search Antibody, Protein, and ELISA Kit Solutions

RASSF2 Antibody - middle region (ARP81311_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
RASSF2
Official Gene Full Name:
Ras association domain family member 2
NCBI Gene Id:
9770
Protein Name:
ras association domain-containing protein 2
Swissprot Id:
P50749
Protein Accession #:
NP_055552.1
Nucleotide Accession #:
NM_014737.2
Alias Symbols:
CENP-34, RASFADIN
Description of Target:
This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported.
Protein Size (# AA):
326
Molecular Weight:
38 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RASSF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RASSF2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RASSF2
Peptide Sequence:
Synthetic peptide located within the following region: SWGLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RASSF2 (ARP81311_P050) antibody is Catalog # AAP81311
Datasheets/Manuals:
Printable datasheet for anti-RASSF2 (ARP81311_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...