Search Antibody, Protein, and ELISA Kit Solutions

RASSF2 Antibody - middle region (ARP81311_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
Ras association domain family member 2
NCBI Gene Id:
Protein Name:
ras association domain-containing protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported.
Protein Size (# AA):
Molecular Weight:
38 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RASSF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RASSF2.
The immunogen is a synthetic peptide directed towards the middle region of human RASSF2
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: SWGLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RASSF2 (ARP81311_P050) antibody is Catalog # AAP81311
Printable datasheet for anti-RASSF2 (ARP81311_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...