Search Antibody, Protein, and ELISA Kit Solutions

RASGRP2 Antibody - middle region (ARP81723_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
RAS guanyl releasing protein 2
NCBI Gene Id:
Protein Name:
RAS guanyl-releasing protein 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Four alternatively spliced transcript variants encoding two different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
66 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RASGRP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RASGRP2.
The immunogen is a synthetic peptide directed towards the middle region of human RASGRP2
Peptide Sequence:
Synthetic peptide located within the following region: RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RASGRP2 (ARP81723_P050) antibody is Catalog # AAP81723
Printable datasheet for anti-RASGRP2 (ARP81723_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...