Search Antibody, Protein, and ELISA Kit Solutions

RARB Antibody - C-terminal region (ARP45601_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45601_P050-FITC Conjugated

ARP45601_P050-HRP Conjugated

ARP45601_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
RARB
Official Gene Full Name:
Retinoic acid receptor, beta
NCBI Gene Id:
5915
Protein Name:
Retinoic acid receptor beta
Swissprot Id:
P10826
Protein Accession #:
NP_000956
Nucleotide Accession #:
NM_000965
Alias Symbols:
HAP, NR1B2, RRB2
Replacement Item:
This antibody may replace item sc-29466 from Santa Cruz Biotechnology.
Description of Target:
RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants; one additional transcript has been described, but its full length nature has not been determined.
Protein Size (# AA):
448
Molecular Weight:
50kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RARB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RARB.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human RARB
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-RARB (ARP45601_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RXRG; RXRB; MEOX2; ITGB1BP2; PRKD2; SMAD2; CCNH; HACE1; PNRC1; NCOR2; EIF3I; NCOA1; MAP6; SRC; RXRA; HR; GATA3; NCOA3; CEBPB; CEBPA; NR4A2; DNMT3B; DNMT3A; DNMT1; HIST4H4; HDAC1;
Blocking Peptide:
For anti-RARB (ARP45601_P050) antibody is Catalog # AAP45601 (Previous Catalog # AAPP11880)
Datasheets/Manuals:
Printable datasheet for anti-RARB (ARP45601_P050) antibody
Target Reference:
Uhl,G.R., (2008) Arch. Gen. Psychiatry 65 (6), 683-693

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...