- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-RAP1GAP (ARP81321_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RAP1GAP |
Purification | Affinity purified |
Peptide Sequence | Synthetic peptide located within the following region: SFIYSTWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASE |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-RAP1GAP (ARP81321_P050) antibody is Catalog # AAP81321 |
Gene Symbol | RAP1GAP |
---|---|
Gene Full Name | RAP1 GTPase activating protein |
Alias Symbols | RAPGAP, RAP1GA1, RAP1GAP1, RAP1GAPII |
NCBI Gene Id | 5909 |
Protein Name | rap1 GTPase-activating protein 1 |
Description of Target | This gene encodes a type of GTPase-activating-protein (GAP) that down-regulates the activity of the ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form. The product of this gene, RAP1GAP, promotes the hydrolysis of bound GTP and hence returns RAP1 to the inactive state whereas other proteins, guanine nucleotide exchange factors (GEFs), act as RAP1 activators by facilitating the conversion of RAP1 from the GDP- to the GTP-bound form. In general, ras subfamily proteins, such as RAP1, play key roles in receptor-linked signaling pathways that control cell growth and differentiation. RAP1 plays a role in diverse processes such as cell proliferation, adhesion, differentiation, and embryogenesis. Alternative splicing results in multiple transcript variants encoding distinct proteins. |
Uniprot ID | P47736 |
Protein Accession # | NP_001139129.1 |
Nucleotide Accession # | NM_001145657.1 |
Protein Size (# AA) | 663 |
Molecular Weight | 72 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RAP1GAP Antibody - C-terminal region (ARP81321_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "RAP1GAP Antibody - C-terminal region (ARP81321_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
-
What buffer format is "RAP1GAP Antibody - C-terminal region (ARP81321_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RAP1GAP Antibody - C-terminal region (ARP81321_P050)"?
This target may also be called "RAPGAP, RAP1GA1, RAP1GAP1, RAP1GAPII" in publications.
-
What is the shipping cost for "RAP1GAP Antibody - C-terminal region (ARP81321_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RAP1GAP Antibody - C-terminal region (ARP81321_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RAP1GAP Antibody - C-terminal region (ARP81321_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "72 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RAP1GAP Antibody - C-terminal region (ARP81321_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RAP1GAP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RAP1GAP"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RAP1GAP"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RAP1GAP"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RAP1GAP"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RAP1GAP"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.