Catalog No: ARP56194_P050
Price: $0.00
SKU
ARP56194_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RAP1B Antibody - N-terminal region (ARP56194_P050)

Datasheets/ManualsPrintable datasheet for anti-RAP1B (ARP56194_P050) antibody
Product Info
ReferenceBernardi,B., (2006) Blood 107 (7), 2728-2735
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RAP1B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-RAP1B (ARP56194_P050) antibody is Catalog # AAP56194 (Previous Catalog # AAPP38115)
Sample Type Confirmation

RAP1B is supported by BioGPS gene expression data to be expressed in PANC1

Gene SymbolRAP1B
Gene Full NameRAP1B, member of RAS oncogene family
Alias SymbolsK-REV, RAL1B
NCBI Gene Id5908
Protein NameRas-related protein Rap-1b
Description of TargetRAP1B and RAP1A (MIM 179520) belong to a superfamily of RAS (see MIM 190020)-like small GTP-binding proteins involved in cell signaling.RAP1B and RAP1A (MIM 179520) belong to a superfamily of RAS (see MIM 190020)-like small GTP-binding proteins involved in cell signaling.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-72 BG717530.1 20-91 73-172 BC000176.3 1-100 173-2026 BC000176.3 110-1963 2027-2117 AA809981.1 1-91 c
Uniprot IDP61224
Protein Accession #NP_001010942
Nucleotide Accession #NM_001010942
Protein Size (# AA)184
Molecular Weight21kDa
Protein InteractionsRASSF5; RPTOR; UBC; VCAM1; RGS2; RALGDS; RGL2; ITGA4; FN1; RAB7B; SMURF2; MOGS; MOV10; ILF2; APP; KRIT1; TP53; LRIF1; CSAD; SDF4; DDAH2; FAF1; CCT7; KMT2B; UNC119; ZNF135; TLE1; PKM; PDHB; CHGB; APLP1; ALAS1; A2M; PRKACA; RAPGEF1; HRAS; RAP1GAP;
  1. What is the species homology for "RAP1B Antibody - N-terminal region (ARP56194_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "RAP1B Antibody - N-terminal region (ARP56194_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RAP1B Antibody - N-terminal region (ARP56194_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RAP1B Antibody - N-terminal region (ARP56194_P050)"?

    This target may also be called "K-REV, RAL1B" in publications.

  5. What is the shipping cost for "RAP1B Antibody - N-terminal region (ARP56194_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RAP1B Antibody - N-terminal region (ARP56194_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RAP1B Antibody - N-terminal region (ARP56194_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RAP1B Antibody - N-terminal region (ARP56194_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RAP1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RAP1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RAP1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RAP1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RAP1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RAP1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RAP1B Antibody - N-terminal region (ARP56194_P050)
Your Rating
We found other products you might like!