Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP53634_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53634_P050-FITC Conjugated

ARP53634_P050-HRP Conjugated

ARP53634_P050-Biotin Conjugated

RANBP9 Antibody - Middle region (ARP53634_P050)

Catalog#: ARP53634_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-271726 from Santa Cruz Biotechnology.
Immunogen The immunogen for Anti-RANBP9 antibody is: synthetic peptide directed towards the Middle region of Human RANB9
Purification Affinity purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-RANBP9 (ARP53634_P050)
Peptide Sequence Synthetic peptide located within the following region: FTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For Anti-RANBP9 antibody is Catalog # AAP53634
Datasheets/Manuals Printable datasheet for anti-RANBP9 (ARP53634_P050) antibody
Target Reference N/A
Gene Symbol RANBP9
Official Gene Full Name RAN binding protein 9
Alias Symbols BPM-L, BPM90, RANBPM, RanBP7
NCBI Gene Id 10048
Protein Name Ran-binding protein 9
Description of Target This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11.
Swissprot Id Q96S59-2
Protein Size (# AA) 388
Molecular Weight 42 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express RANBP9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express RANBP9.
Protein Interactions RAF1; AXL; CACNA1G; Cit; COPS5; FMR1; ESR1; DRD1; BACE1; ADAP1; L1cam; ADAP2; CDK11B; ENTPD1; CD4; AR; APP; RANBP9; THRB; THRA; TFRC; RAN; PRKCG; PRKCD; NTRK2; MKLN1; LRP1; ITGB2; ITGB1; HMBS; NEDD8; HDAC6; FXR1; SUMO1; CBS; UBE2I; WDR26; TSR1; GID8; RPS2
  1. What is the species homology for "RANBP9 Antibody - Middle region (ARP53634_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "RANBP9 Antibody - Middle region (ARP53634_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "RANBP9 Antibody - Middle region (ARP53634_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RANBP9 Antibody - Middle region (ARP53634_P050)"?

    This target may also be called "BPM-L, BPM90, RANBPM, RanBP7" in publications.

  5. What is the shipping cost for "RANBP9 Antibody - Middle region (ARP53634_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RANBP9 Antibody - Middle region (ARP53634_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RANBP9 Antibody - Middle region (ARP53634_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RANBP9 Antibody - Middle region (ARP53634_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "RANBP9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RANBP9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RANBP9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RANBP9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RANBP9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RANBP9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RANBP9 Antibody - Middle region (ARP53634_P050)
Your Rating
We found other products you might like!