Search Antibody, Protein, and ELISA Kit Solutions

RANBP9 Antibody - Middle region (ARP53634_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53634_P050-FITC Conjugated

ARP53634_P050-HRP Conjugated

ARP53634_P050-Biotin Conjugated

Gene Symbol:
RANBP9
Official Gene Full Name:
RAN binding protein 9
NCBI Gene Id:
10048
Protein Name:
Ran-binding protein 9
Swissprot Id:
Q96S59-2
Alias Symbols:
BPM-L, BPM90, RANBPM, RanBP7
Replacement Item:
This antibody may replace item sc-271726 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11.
Protein Size (# AA):
388
Molecular Weight:
42 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RANBP9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RANBP9.
Immunogen:
The immunogen for Anti-RANBP9 antibody is: synthetic peptide directed towards the Middle region of Human RANB9
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-RANBP9 (ARP53634_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RAF1; AXL; CACNA1G; Cit; COPS5; FMR1; ESR1; DRD1; BACE1; ADAP1; L1cam; ADAP2; CDK11B; ENTPD1; CD4; AR; APP; RANBP9; THRB; THRA; TFRC; RAN; PRKCG; PRKCD; NTRK2; MKLN1; LRP1; ITGB2; ITGB1; HMBS; NEDD8; HDAC6; FXR1; SUMO1; CBS; UBE2I; WDR26; TSR1; GID8; RPS2
Blocking Peptide:
For Anti-RANBP9 antibody is Catalog # AAP53634
Datasheets/Manuals:
Printable datasheet for anti-RANBP9 (ARP53634_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...