RANBP6 Antibody - middle region (ARP79451_P050)

Catalog No: ARP79451_P050

Host: Rabbit
Target Name: SEC23IP
Sample Tissue: Human A172 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human SEC23IP
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PSSLMGINSYLPSQPSSLPPSYFGNQPQGIPQPGYNPYRHTPGSSRANPY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SEC23IP (ARP79451_P050) antibody is Catalog # AAP79451

Target Info

• Gene Symbol: SEC23IP
• Gene Full Name: SEC23 interacting protein
• Alias Symbols: P125, P125A, MSTP053, iPLA1beta
• NCBI Gene Id: 11196
• Protein Name: SEC23-interacting protein
• Description of Target: This gene encodes a member of the phosphatidic acid preferring-phospholipase A1 family. The encoded protein is localized to endoplasmic reticulum exit sites and plays a critical role in ER-Golgi transport as part of the multimeric coat protein II complex. An orthologous gene in frogs is required for normal neural crest cell development, suggesting that this gene may play a role in Waardenburg syndrome neural crest defects. Alternatively spliced transcript variants have been observed for this gene.
• Uniprot ID: Q9Y6Y8
• Protein Accession #: NP_009121.1
• Nucleotide Accession #: NM_007190.3
• Protein Size (# AA): 1000
• Molecular Weight: 110 kDa