- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for RAMP2 Antibody (OAAL00507) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 2F5 |
Isotype | IgG1 Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | RAMP2 (NP_005845.1, 58 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | VKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDV |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | RAMP2 |
---|---|
Gene Full Name | receptor activity modifying protein 2 |
Alias Symbols | calcitonin receptor-like receptor activity modifying protein 2;CRLR activity-modifying protein 2;receptor (calcitonin) activity modifying protein 2;receptor (G protein-coupled) activity modifying protein 2;receptor activity-modifying protein 2. |
NCBI Gene Id | 10266 |
Protein Name | Homo sapiens receptor activity modifying protein 2 (RAMP2), mRNA|receptor activity-modifying protein 2 precursor [Homo sapiens] |
Description of Target | The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface. [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_005845.1 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_005854 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RAMP2 Antibody (OAAL00507)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "RAMP2 Antibody (OAAL00507)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "RAMP2 Antibody (OAAL00507)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RAMP2 Antibody (OAAL00507)"?
This target may also be called "calcitonin receptor-like receptor activity modifying protein 2;CRLR activity-modifying protein 2;receptor (calcitonin) activity modifying protein 2;receptor (G protein-coupled) activity modifying protein 2;receptor activity-modifying protein 2." in publications.
-
What is the shipping cost for "RAMP2 Antibody (OAAL00507)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RAMP2 Antibody (OAAL00507)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RAMP2 Antibody (OAAL00507)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RAMP2 Antibody (OAAL00507)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RAMP2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RAMP2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RAMP2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RAMP2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RAMP2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RAMP2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.