- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for RAGE Antibody - N-terminal region (OABB01952) |
---|
Tested Species Reactivity | Human, Mouse, Rat |
---|---|
Predicted Species Reactivity | Human|Mouse|Rat |
Product Format | Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Immunohistochemistry|Western blot |
Additional Information | Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment. |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | Polypeptide |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: IQDEGIFRCQAMNRNGKETKSNYRVRVYQI |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Human, Rat Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat |
Reference | 1. Bierhaus A, Haslbeck KM, Humpert PM, Liliensiek B, Dehmer T, Morcos M, Sayed AA, Andrassy M, Schiekofer S, Schneider JG, Schulz JB, Heuss D, Neundorfer B, Dierl S, Huber J, Tritschler H, Schmidt AM, Schwaninger M, Haering HU, Schleicher E, Kasper M, Stern DM, Arnold B, Nawroth PP. Loss of pain perception in diabetes is dependent on a receptor of the immunoglobulin superfamily. J Clin Invest. 2004 Dec; 114(12):1741-51. 2. Chavakis T, Bierhaus A, Al-Fakhri N, Schneider D, Witte S, Linn T, Nagashima M, Morser J, Arnold B, Preissner KT, Nawroth PP. The pattern recognition receptor (RAGE) is a counterreceptor for leukocyte integrins: a novel pathway for inflammatory cell recruitment. J Exp Med. 2003 Nov 17; 198(10):1507-15. 3. Hofmann MA, Drury S, Fu C, Qu W, Taguchi A, Lu Y, Avila C, Kambham N, Bierhaus A, Nawroth P, Neurath MF, Slattery T, Beach D, McClary J, Nagashima M, Morser J, Stern D, Schmidt AM. RAGE mediates a novel proinflammatory axis: a central cell surface receptor for S100/calgranulin polypeptides. Cell. 1999 Jun 25; 97(7):889-901. 4. Taguchi A, Blood DC, del Toro G, Canet A, Lee DC, Qu W, Tanji N, Lu Y, Lalla E, Fu C, Hofmann MA, Kislinger T, Ingram M, Lu A, Tanaka H, Hori O, Ogawa S, Stern DM, Schmidt AM. Blockade of RAGE-amphoterin signalling suppresses tumour growth and metastases. Nature.2000 May 18; 405(6784):354-60. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Description | Rabbit IgG polyclonal antibody for Advanced glycosylation end product-specific receptor (AGER) detection. Tested with WB, IHC-P in Human;Mouse;Rat. |
Gene Symbol | AGER |
---|---|
Gene Full Name | advanced glycosylation end-product specific receptor |
Alias Symbols | advanced glycosylation end product-specific receptor;RAGE;receptor for advanced glycation end-products variant 20;Receptor for advanced glycosylation end products;SCARJ1;sRAGE. |
NCBI Gene Id | 177 |
Protein Name | Advanced glycosylation end product-specific receptor |
Description of Target | Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Can also bind oligonucleotides. |
Uniprot ID | Q15109 |
Molecular Weight | 42803 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RAGE Antibody - N-terminal region (OABB01952)"?
The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "RAGE Antibody - N-terminal region (OABB01952)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "RAGE Antibody - N-terminal region (OABB01952)" provided in?
This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RAGE Antibody - N-terminal region (OABB01952)"?
This target may also be called "advanced glycosylation end product-specific receptor;RAGE;receptor for advanced glycation end-products variant 20;Receptor for advanced glycosylation end products;SCARJ1;sRAGE." in publications.
-
What is the shipping cost for "RAGE Antibody - N-terminal region (OABB01952)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RAGE Antibody - N-terminal region (OABB01952)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RAGE Antibody - N-terminal region (OABB01952)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "42803 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RAGE Antibody - N-terminal region (OABB01952)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "AGER"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "AGER"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "AGER"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "AGER"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "AGER"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "AGER"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.