RAE1 Antibody - C-terminal region (ARP40302_P050)

Catalog No: ARP40302_P050

Host: Rabbit
Target Name: RAE1
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml

Rabbit Anti-RAE1 Antibody
Catalog Number: ARP40302
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RAE1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RAE1 (ARP40302_P050) antibody is Catalog # AAP40302 (Previous Catalog # AAPP10339)
• Sample Type Confirmation:

  RAE1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Blower,M.D., (2005) Cell 121 (2), 223-234

Target Info

• Gene Symbol: RAE1
• Gene Full Name: RAE1 RNA export 1 homolog (S. pombe)
• Alias Symbols: Gle2, MIG14, MRNP41, Mnrp41, dJ481F12.3, dJ800J21.1
• NCBI Gene Id: 8480
• Protein Name: mRNA export factor
• Description of Target: RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Uniprot ID: P78406
• Protein Accession #: NP_001015885
• Nucleotide Accession #: NM_001015885
• Protein Size (# AA): 368
• Molecular Weight: 41 kDa
• Protein Interactions: TP53; CDC37; DGCR8; YAP1; STK3; EEF2K; SOX2; HNRNPUL1; YWHAQ; UBC; FN1; ZC3HAV1; UBD; DDX39B; NUP98; MAP2; NUMA1; RNA28S5; RNA18S5; LSM14A; IGF2BP3; NXF1; TACC3; DYNLL1; KHSRP; KPNB1; ILF3; COPS6; CUL1; CUL3; Nup214; Nup188; KAT2A; PTTG1; POLR3H; FAM122B;