Search Antibody, Protein, and ELISA Kit Solutions

RAD54B Antibody - N-terminal region (ARP36407_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP36407_P050-FITC Conjugated

ARP36407_P050-HRP Conjugated

ARP36407_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-101234 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human RAD54B
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 100%
Complete computational species homology data:
Anti-RAD54B (ARP36407_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RAD54B (ARP36407_P050) antibody is Catalog # AAP36407 (Previous Catalog # AAPP08463)
Datasheets/Manuals:
Printable datasheet for anti-RAD54B (ARP36407_P050) antibody
Target Reference:
Brys,M., (2007) Pol J Pathol 58 (1), 3-6
Gene Symbol:
RAD54B
Official Gene Full Name:
RAD54 homolog B (S. cerevisiae)
Alias Symbols:
FSBP, RDH54
NCBI Gene Id:
25788
Protein Name:
DNA repair and recombination protein RAD54B
Description of Target:
RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.
Swissprot Id:
Q9Y620
Protein Accession #:
NP_036547
Nucleotide Accession #:
NM_012415
Protein Size (# AA):
910
Molecular Weight:
103kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RAD54B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RAD54B.
Protein Interactions:
TCEANC; ATPAF2; ANKRD36BP1; ENKD1; MYO15B; GMCL1; RAD54B; CDC23; SUMO1; PRKAA1; FUS; HECW2; PSMA1; RAD51; NUDT18; NIF3L1; TCEB3; COPS6; SUMO2; UBC; WRN; ZNF580; LNX1; TRAPPC6A; RIBC2; CCDC33; UBE2I; GORASP2; DYRK2; DMC1; CSNK1E; CD2BP2;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...