Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RAD54B antibody - N-terminal region (ARP36407_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP36407_P050-FITC Conjugated

ARP36407_P050-HRP Conjugated

ARP36407_P050-Biotin Conjugated

Gene Symbol:
RAD54B
NCBI Gene Id:
25788
Official Gene Full Name:
RAD54 homolog B (S. cerevisiae)
Protein Name:
DNA repair and recombination protein RAD54B
Swissprot Id:
Q9Y620
Protein Accession #:
NP_036547
Nucleotide Accession #:
NM_012415
Alias Symbols:
FSBP, RDH54
Replacement Item:
This antibody may replace item sc-101234 from Santa Cruz Biotechnology.
Description of Target:
RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.
Protein Size (# AA):
910
Molecular Weight:
103kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RAD54B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RAD54B.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human RAD54B
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 100%
Complete computational species homology data:
Anti-RAD54B (ARP36407_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TCEANC; ATPAF2; ANKRD36BP1; ENKD1; MYO15B; GMCL1; RAD54B; CDC23; SUMO1; PRKAA1; FUS; HECW2; PSMA1; RAD51; NUDT18; NIF3L1; TCEB3; COPS6; SUMO2; UBC; WRN; ZNF580; LNX1; TRAPPC6A; RIBC2; CCDC33; UBE2I; GORASP2; DYRK2; DMC1; CSNK1E; CD2BP2;
Blocking Peptide:
For anti-RAD54B (ARP36407_P050) antibody is Catalog # AAP36407 (Previous Catalog # AAPP08463)
Datasheets/Manuals:
Printable datasheet for anti-RAD54B (ARP36407_P050) antibody
Target Reference:
Brys,M., (2007) Pol J Pathol 58 (1), 3-6

Tell us what you think about this item!

Write A Review
    Please, wait...