Search Antibody, Protein, and ELISA Kit Solutions

RAD51 Antibody - N-terminal region (ARP72475_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP72475_P050-FITC Conjugated

ARP72475_P050-HRP Conjugated

ARP72475_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-36360 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD51
Purification:
Affinity Purified
Peptide Sequence:
Synthetic peptide located within the following region: VEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RAD51 (ARP72475_P050) antibody is Catalog # AAP72475
Datasheets/Manuals:
Printable datasheet for anti-RAD51 (ARP72475_P050) antibody
Gene Symbol:
RAD51
Alias Symbols:
RAD51, RAD51A, RECA,
NCBI Gene Id:
5888
Description of Target:
The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
Swissprot Id:
Q06609-3
Protein Size (# AA):
280
Molecular Weight:
30kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RAD51.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RAD51.
Protein Interactions:
BRCA1; ATRX; FBXO18; PALB2; HNRNPC; SWSAP1; HNRNPA2B1; RPA3; RPA1; RAD52; PFN1; RAD54B; AICDA; BLM; DMC1; NXF1; RECQL5; UGDH; CHEK1; BRCA2; SFR1; SWI5; NEDD8; PML; TERF2IP; TP53; MSH2; MSH6; UBC; UHRF2; RAD51AP1; WRN; POLN; MORF4L1; MDC1; RAD51C; MCPH1; S

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...