Search Antibody, Protein, and ELISA Kit Solutions

RAD51 Antibody - N-terminal region (ARP33450_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP33450_P050-FITC Conjugated

ARP33450_P050-HRP Conjugated

ARP33450_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Additional Information:
IHC Information: Adrenal
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-36360 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human RAD51
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Goat: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 93%
Complete computational species homology data:
Anti-RAD51 (ARP33450_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RAD51 (ARP33450_P050) antibody is Catalog # AAP33450 (Previous Catalog # AAPP04496)
Datasheets/Manuals:
Printable datasheet for anti-RAD51 (ARP33450_P050) antibody
Sample Type Confirmation:

RAD51 is supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

Target Reference:
Park,J.Y., (2008) Nucleic Acids Res. 36 (10), 3226-3234
Gene Symbol:
RAD51
Official Gene Full Name:
RAD51 homolog (S. cerevisiae)
Alias Symbols:
BRCC5, HRAD51, HsRad51, HsT16930, RAD51A, RECA
NCBI Gene Id:
5888
Protein Name:
DNA repair protein RAD51 homolog 1
Description of Target:
RAD51 is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist.
Swissprot Id:
Q06609-2
Protein Accession #:
NP_597994
Nucleotide Accession #:
NM_133487
Protein Size (# AA):
242
Molecular Weight:
26kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RAD51.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RAD51.
Protein Interactions:
BRCA1; ATRX; FBXO18; PALB2; HNRNPC; SWSAP1; HNRNPA2B1; RPA3; RPA1; RAD52; PFN1; RAD54B; AICDA; BLM; DMC1; NXF1; RECQL5; UGDH; CHEK1; BRCA2; SFR1; SWI5; NEDD8; PML; TERF2IP; TP53; MSH2; MSH6; UBC; UHRF2; RAD51AP1; WRN; POLN; MORF4L1; MDC1; RAD51C; MCPH1; S

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 15:23
  • Overall Experience:
  • Quality:
Product Review: RAD51 antibody - N-terminal region (ARP33450_P050) in 293T cell lysate using Western blot

Product page for RAD51 antibody - N-terminal region (ARP33450_P050)

Researcher: Anonymous
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 20ug 293T cell lysate
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:5000

Questionnaire:  
How do Aviva's reagents play a role in your experimental goals? This antibody is used for western blot analysis and worked very well
How would you rate this antibody on a scale from 1-5 (5=best) and why? 5
Would you use this antibody in future experiments? yes
Have you used another antibody which has worked in your application? yes
Do you believe the information about the reagent on Aviva's website is correct? yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? yes
How did you store the antibody after re-suspension? kept it in -20 degree C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): human, 293T cell, 20ug of cellular extract
How many different experimental trials were conducted using the antibody sample? 1
How was this sample prepared? 293T cells are lysed by RIPA buffer and 20 ug of cellular extract was loaded on 8% SDS-PAGE gel.
proteins are transferred to PVDF membrane.
Primary antibody dilution and incubation time: 5ug of antibody in 5ml antibody dilution buffer. 1 hr incubation.
Secondary antibody used and dilution and incubation time: anti rabbit-HRP conjugate antibody. 1;5000 dilution, 1hr
What controls were used in your experiment (positive/negative)? beta-tubuline for positive and loading control
Please include your detailed WB Procedure/Protocol here: 293Tcells were washed with PBS buffer and lysed with RIPA buffer (1x PBS, 1% IP-40, 0.5% sodium deoxycholate, 0.1% SDS). After 1h incubation on ice, cellular mixture was centrifuged and the supernatant was collected. Equivalent amounts (approximately 20ug) of prepared cellular extracts were separated on a 10% SDS-polyacrylamide gel and transferred to a PVDF membrane (Bio-rad). The membranes were probed with Mus81 antibody followed by anti-rabbit secondary antibodies conjugated with horseradish peroxidase. The signals were detected using ECL-Plus (Amersham). To confirm equal loading, blots were stripped with stripping solution (Chemicon) and reprobed with anti-β-tubulin antibody (Santa Cruz Biotechnology).
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...