RAD50 Antibody - middle region (ARP87341_P050)

Catalog No: ARP87341_P050

Host: Rabbit
Target Name: RAD50
Sample Tissue: Human LN18 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD50
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: EELINKKNTSNKIAQDKLNDIKEKVKNIHGYMKDIENYIQDGKDDYKKQK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RAD50 (ARP87341_P050) antibody is Catalog # AAP87341

Target Info

• Gene Symbol: RAD50
• Gene Full Name: RAD50 double strand break repair protein
• Alias Symbols: NBSLD, RAD502, hRad50
• NCBI Gene Id: 10111
• Protein Name: DNA repair protein RAD50
• Description of Target: The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Rad50, a protein involved in DNA double-strand break repair. This protein forms a complex with MRE11 and NBS1. The protein complex binds to DNA and displays numerous enzymatic activities that are required for nonhomologous joining of DNA ends. This protein, cooperating with its partners, is important for DNA double-strand break repair, cell cycle checkpoint activation, telomere maintenance, and meiotic recombination. Knockout studies of the mouse homolog suggest this gene is essential for cell growth and viability. Mutations in this gene are the cause of Nijmegen breakage syndrome-like disorder.
• Uniprot ID: Q92878-3
• Protein Accession #: NP_005723.2
• Nucleotide Accession #: NM_005732.3
• Protein Size (# AA): 1173
• Molecular Weight: 129 kDa