Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RABL4 antibody - C-terminal region (ARP48306_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP48306_P050-FITC Conjugated

ARP48306_P050-HRP Conjugated

ARP48306_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
IFT27
NCBI Gene Id:
11020
Official Gene Full Name:
Intraflagellar transport 27 homolog (Chlamydomonas)
Protein Name:
Intraflagellar transport protein 27 homolog
Swissprot Id:
Q9BW83-2
Protein Accession #:
NP_006851
Nucleotide Accession #:
NM_006860
Alias Symbols:
RAYL, RABL4
Description of Target:
RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.This gene encodes a putative GTP-binding protein similar to RAY/RAB1C. The protein is ras-related, but the function is unknown.
Protein Size (# AA):
185
Molecular Weight:
20kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RABL4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RABL4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human RABL4
Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Human: 100%; Mouse: 79%; Pig: 85%; Rat: 79%; Sheep: 86%
Complete computational species homology data:
Anti-RABL4 (ARP48306_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HSPB11; GOLGA2; PRDX5;
Blocking Peptide:
For anti-IFT27 (ARP48306_P050) antibody is Catalog # AAP48306 (Previous Catalog # AAPY01676)
Datasheets/Manuals:
Printable datasheet for anti-IFT27 (ARP48306_P050) antibody
Sample Type Confirmation:

IFT27 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Collins,J.E., Genome Biol. 5 (10), R84 (2004)

Tell us what you think about this item!

Write A Review
    Please, wait...