Rabbit anti-human sarcolipin (OACA02358)

Catalog No: OACA02358

Size:50ul

Sample: human heart tissue;
Primary Antibody Dilution: 1:500

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat
• Product Format: Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
• Clonality: Polyclonal
• Isotype: IgG
• Host: Rabbit
• Application: WB
• Additional Information: Subcellular Location: Sarcoplasmic reticulum membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein.
• Reconstitution and Storage: Upon receipt store at -20C or -80C. Avoid freeze/thaw cycles.
• Immunogen: Human SLN (1-31aa): MGINTRELFLNFTIVLITVILMWLLVRSYQY
• Purification: Antigen affinity purified
• Concentration: Varies by lot. See vial for exact concentration.

Target Info

• Gene Symbol: SLN
• Alias Symbols: sarcolipin, SLN, MGC12301, MGC125854, MGC125855
• NCBI Gene Id: 100009246
• Description of Target: Sarcoplasmic reticulum Ca(2+)-ATPases are transmembrane proteins that catalyze the ATP-dependent transport of Ca(2+) from the cytosol into the lumen of the sarcoplasmic reticulum in muscle cells. This gene encodes a small proteolipid that regulates several sarcoplasmic reticulum Ca(2+)-ATPases. The transmembrane protein interacts with Ca(2+)-ATPases and reduces the accumulation of Ca(2+) in the sarcoplasmic reticulum without affecting the rate of ATP hydrolysis.
• Uniprot ID: P42532
• Protein Accession #: NP_001075856.1