Size:50 ul
$500.00
In Stock
SKU
OACA02358
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Rabbit anti-human sarcolipin (OACA02358)

Catalog#: OACA02358
Domestic: within 1-2 weeks delivery | International: 1-2 weeks
More Information
Predicted Species Reactivity Human, Mouse, Rat
Product Format Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Clonality Polyclonal
Isotype IgG
Host Rabbit
Application WB
Additional Information Subcellular Location: Sarcoplasmic reticulum membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein.
Reconstitution and Storage Upon receipt store at -20C or -80C. Avoid freeze/thaw cycles.
Immunogen Human SLN (1-31aa): MGINTRELFLNFTIVLITVILMWLLVRSYQY
Purification Antigen affinity purified
Concentration Varies by lot. See vial for exact concentration.
Datasheets/Manuals Printable datasheet for Rabbit anti-human sarcolipin (OACA02358)OACA02358
Gene Symbol SLN
Alias Symbols sarcolipin, SLN, MGC12301, MGC125854, MGC125855
NCBI Gene Id 100009246
Description of Target Sarcoplasmic reticulum Ca(2+)-ATPases are transmembrane proteins that catalyze the ATP-dependent transport of Ca(2+) from the cytosol into the lumen of the sarcoplasmic reticulum in muscle cells. This gene encodes a small proteolipid that regulates several sarcoplasmic reticulum Ca(2+)-ATPases. The transmembrane protein interacts with Ca(2+)-ATPases and reduces the accumulation of Ca(2+) in the sarcoplasmic reticulum without affecting the rate of ATP hydrolysis.
Swissprot Id P42532
Protein Accession # NP_001075856.1
  1. What is the species homology for "Rabbit anti-human sarcolipin (OACA02358)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "Rabbit anti-human sarcolipin (OACA02358)"?

    This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".

  3. What buffer format is "Rabbit anti-human sarcolipin (OACA02358)" provided in?

    This item is provided in "Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Rabbit anti-human sarcolipin (OACA02358)"?

    This target may also be called "sarcolipin, SLN, MGC12301, MGC125854, MGC125855" in publications.

  5. What is the shipping cost for "Rabbit anti-human sarcolipin (OACA02358)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Rabbit anti-human sarcolipin (OACA02358)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Rabbit anti-human sarcolipin (OACA02358)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Rabbit anti-human sarcolipin (OACA02358)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SLN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLN"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLN"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLN"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLN"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Rabbit anti-human sarcolipin (OACA02358)
Your Rating
We found other products you might like!