Search Antibody, Protein, and ELISA Kit Solutions

Rabbit anti-human sarcolipin (OACA02358)

50 ul
$500.00
In Stock
Request Bulk Order Quote

Predicted Species Reactivity:
Human, Mouse, Rat
Product Format:
Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Clonality:
Polyclonal
Isotype:
IgG
Host:
Rabbit
Application:
WB, ELISA
Additional Information:
Subcellular Location: Sarcoplasmic reticulum membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein.
Reconstitution and Storage:
Upon receipt store at -20C or -80C. Avoid freeze/thaw cycles.
Gene Symbol:
SLN
NCBI Gene Id:
100009246
Swissprot Id:
P42532
Protein Accession #:
NP_001075856.1
Alias Symbols:
sarcolipin, SLN, MGC12301, MGC125854, MGC125855
Description of Target:
Sarcoplasmic reticulum Ca(2+)-ATPases are transmembrane proteins that catalyze the ATP-dependent transport of Ca(2+) from the cytosol into the lumen of the sarcoplasmic reticulum in muscle cells. This gene encodes a small proteolipid that regulates several sarcoplasmic reticulum Ca(2+)-ATPases. The transmembrane protein interacts with Ca(2+)-ATPases and reduces the accumulation of Ca(2+) in the sarcoplasmic reticulum without affecting the rate of ATP hydrolysis.
Purification:
Antigen affinity purified
Immunogen:
Human SLN (1-31aa): MGINTRELFLNFTIVLITVILMWLLVRSYQY
Concentration:
Varies by lot. See vial for exact concentration.
Datasheets/Manuals:
Printable datasheet for Rabbit anti-human sarcolipin (OACA02358)OACA02358

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...