- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-RAB8A (AVARP13076_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Pig, Sheep, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAB8A |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Human: 100%; Mouse: 85%; Pig: 100%; Rat: 85%; Sheep: 100%; Zebrafish: 85% |
Peptide Sequence | Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-RAB8A (AVARP13076_P050-FITC) antibody is Catalog # AAP30723 (Previous Catalog # AAPP01380) |
Sample Type Confirmation | RAB8A is supported by BioGPS gene expression data to be expressed in 721_B |
Reference | Roland,J.T., (2007) Mol. Biol. Cell 18 (8), 2828-2837 |
---|---|
Gene Symbol | RAB8A |
Gene Full Name | RAB8A, member RAS oncogene family |
Alias Symbols | MEL, RAB8 |
NCBI Gene Id | 4218 |
Protein Name | Ras-related protein Rab-8A |
Description of Target | RAB8A is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable.The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P61006 |
Protein Accession # | NP_005361 |
Nucleotide Accession # | NM_005370 |
Protein Size (# AA) | 207 |
Molecular Weight | 24kDa |
Protein Interactions | TFRC; SYTL4; SYTL1; TBC1D17; STAU1; UBC; MDM2; RPA3; RPA2; RPA1; STK4; OPTN; Myo5b; MYO5C; EHD3; EHD1; UBL4A; RAB1B; RAB31; COX5A; RAB11B; RAB7A; SCP2; RRBP1; NDUFA7; IDH3G; SNCA; ELAVL1; Rab8a; RPH3A; RAB3IP; RIMS2; RPH3AL; RABIF; MAP4K2; PDE6D; GDI2; OC |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RAB8A Antibody - middle region : FITC (AVARP13076_P050-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig, Sheep, Zebrafish".
-
How long will it take to receive "RAB8A Antibody - middle region : FITC (AVARP13076_P050-FITC)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "RAB8A Antibody - middle region : FITC (AVARP13076_P050-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RAB8A Antibody - middle region : FITC (AVARP13076_P050-FITC)"?
This target may also be called "MEL, RAB8" in publications.
-
What is the shipping cost for "RAB8A Antibody - middle region : FITC (AVARP13076_P050-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RAB8A Antibody - middle region : FITC (AVARP13076_P050-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RAB8A Antibody - middle region : FITC (AVARP13076_P050-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "24kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RAB8A Antibody - middle region : FITC (AVARP13076_P050-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RAB8A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RAB8A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RAB8A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RAB8A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RAB8A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RAB8A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.