Search Antibody, Protein, and ELISA Kit Solutions

RAB35 Antibody - middle region (ARP52268_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52268_P050-FITC Conjugated

ARP52268_P050-HRP Conjugated

ARP52268_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
RAB35
Official Gene Full Name:
RAB35, member RAS oncogene family
NCBI Gene Id:
11021
Protein Name:
Ras-related protein Rab-35
Swissprot Id:
Q15286
Protein Accession #:
NP_006852
Nucleotide Accession #:
NM_006861
Alias Symbols:
H-ray, RAB1C, RAY
Replacement Item:
This antibody may replace item sc-109473 from Santa Cruz Biotechnology.
Description of Target:
RAB35 possesses GTPase activity.
Protein Size (# AA):
201
Molecular Weight:
23kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RAB35.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RAB35.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RAB35
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-RAB35 (ARP52268_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; RPA3; RPA2; RPA1; AMOT; LATS1; Ccdc64b; IQCB1; UBL4A; FN1; ATP6V1B1; APP; ATG16L1; ALK; TBPL1; C2orf44; CBR3; IDH3B; GNPAT; PTPRS;
Blocking Peptide:
For anti-RAB35 (ARP52268_P050) antibody is Catalog # AAP52268 (Previous Catalog # AAPP44029)
Datasheets/Manuals:
Printable datasheet for anti-RAB35 (ARP52268_P050) antibody

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

78/03/2019 02:55
  • Overall Experience:
  • Quality:
J774A.1 cells in IF

Submitted by:
Lucius Chiaraviglio
Beth Israel Deaconess Medical Center

“Antibody seems good (rating 5), but unfortunately our cells only exhibit Rab35 on a very small fraction of Legionella-infected vacuoles.”

RAB35

1. Species and tissue/cell type used: Used J774A.1 cells (transformed macrophage-like cells originally from A/J mice).

2. Fixation method: Fixed with 4% formaldehyde in PBS containing Ca2+ and Mg2+ (caution: before using, check pH to make sure it is between 7 and 7.5).

3. Antigen retrieval method: No antigen retrieval method; permeabilized with 0.2% saponin in PBS lacking Ca2+ and Mg2.

4. Primary antibody dilution: 1:250 in 2% donkey serum + 0.1% saponin in PBS lacking Ca2+ and Mg2+.

5. Secondary antibody and dilution: Secondary antibody was Donkey F(ab’)2 fragment anti-rabbit secondary antibody conjugated to far red fluorophore Alexa 647. Secondary antibody diluted 1:375 (target final concentration 2.0 ug/ml).

6. Stain/counterstain: No counterstain – used bacteria expressing green fluorescent protein mClover (JK385a, JK381a) or eGFP (JK260).

7. Protocol: Infected J774A.1 cells at target multiplicity of infection with lab strains of Legionella pneumophila (JK385a = dotA mutant, defective in dot/icm Type IV secretion system) or a clinical strain of the same species (JK260 = dotA wild-type and lacks other mutations of the lab strains) before fixation.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...