Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RAB1A antibody - middle region (ARP56561_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP56561_P050-FITC Conjugated

ARP56561_P050-HRP Conjugated

ARP56561_P050-Biotin Conjugated

Gene Symbol:
RAB1A
NCBI Gene Id:
5861
Official Gene Full Name:
RAB1A, member RAS oncogene family
Protein Name:
Ras-related protein Rab-1A
Swissprot Id:
P62820
Protein Accession #:
NP_004152
Nucleotide Accession #:
NM_004161
Alias Symbols:
DKFZP564B163, RAB1, YPT1
Replacement Item:
This antibody may replace item sc-177809 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl
Protein Size (# AA):
205
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RAB1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RAB1A.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RAB1A
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-RAB1A (ARP56561_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RUSC2; SART3; UBC; ASB9; ASB5; RPA3; RPA2; RPA1; MTPN; TUBB4B; GMPS; PCYT2; PNP; MTAP; PDIA3; ENO2; ATP6V1A; RABAC1; ATP4A; BAG3; Arhgdib; UBL4A; IQCB1; RAB31; RAB11B; RAB11A; RAB7A; RAP1A; PTBP1; GDI2; GDI1; HNRNPA3; HNRNPA1L2; ARRB1; ELAVL1; UL27; SUMO2
Blocking Peptide:
For anti-RAB1A (ARP56561_P050) antibody is Catalog # AAP56561 (Previous Catalog # AAPP39218)
Datasheets/Manuals:
Printable datasheet for anti-RAB1A (ARP56561_P050) antibody
Sample Type Confirmation:

RAB1A is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Diao,A., (2008) J. Biol. Chem. 283 (11), 6957-6967

Tell us what you think about this item!

Write A Review
    Please, wait...