Search Antibody, Protein, and ELISA Kit Solutions

RAB1A Antibody - middle region (ARP56561_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56561_P050-FITC Conjugated

ARP56561_P050-HRP Conjugated

ARP56561_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
RAB1A, member RAS oncogene family
NCBI Gene Id:
Protein Name:
Ras-related protein Rab-1A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZP564B163, RAB1, YPT1
Replacement Item:
This antibody may replace item sc-177809 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RAB1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RAB1A.
The immunogen is a synthetic peptide directed towards the middle region of human RAB1A
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-RAB1A (ARP56561_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RAB1A (ARP56561_P050) antibody is Catalog # AAP56561 (Previous Catalog # AAPP39218)
Printable datasheet for anti-RAB1A (ARP56561_P050) antibody
Sample Type Confirmation:

RAB1A is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Diao,A., (2008) J. Biol. Chem. 283 (11), 6957-6967

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...