Search Antibody, Protein, and ELISA Kit Solutions

PYGM Antibody - C-terminal region : HRP (ARP74158_P050-HRP)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74158_P050 Unconjugated

ARP74158_P050-FITC Conjugated

ARP74158_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-130860 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PYGM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PYGM.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PYGM
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: TIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPE
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PYGM (ARP74158_P050-HRP) antibody is Catalog # AAP74158
Printable datasheet for anti-PYGM (ARP74158_P050-HRP) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...