Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

PYGM Antibody - C-terminal region : FITC (ARP74158_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74158_P050 Unconjugated

ARP74158_P050-HRP Conjugated

ARP74158_P050-Biotin Conjugated

Gene Symbol:
PYGM
NCBI Gene Id:
5837
Swissprot Id:
P11217-2
Alias Symbols:
PYGM,
Replacement Item:
This antibody may replace item sc-130860 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
754
Molecular Weight:
82kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PYGM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PYGM.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PYGM
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: TIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
WDYHV1; PRKAB2; UBC; S100A1; TOP1; PPP2R5A; Ccdc15; PYGM; TRIM63; PACSIN3; DEGS1;
Blocking Peptide:
For anti-PYGM (ARP74158_P050-FITC) antibody is Catalog # AAP74158
Datasheets/Manuals:
Printable datasheet for anti-PYGM (ARP74158_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...