Size:100 ul
$289.00
In Stock
SKU
ARP74158_P050-Biotin
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74158_P050 Unconjugated

ARP74158_P050-FITC Conjugated

ARP74158_P050-HRP Conjugated

PYGM Antibody - C-terminal region : Biotin (ARP74158_P050-Biotin)

Catalog#: ARP74158_P050-Biotin
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-130860 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human PYGM
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: TIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPE
Concentration0.5 mg/ml
Blocking PeptideFor anti-PYGM (ARP74158_P050-Biotin) antibody is Catalog # AAP74158
Datasheets/ManualsPrintable datasheet for anti-PYGM (ARP74158_P050-Biotin) antibody
Gene SymbolPYGM
Alias SymbolsPYGM,
NCBI Gene Id5837
Description of TargetThis gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.
Swissprot IdP11217-2
Protein Size (# AA)754
Molecular Weight82kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express PYGM.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express PYGM.
Protein InteractionsWDYHV1; PRKAB2; UBC; S100A1; TOP1; PPP2R5A; Ccdc15; PYGM; TRIM63; PACSIN3; DEGS1;
Write Your Own Review
You're reviewing:PYGM Antibody - C-terminal region : Biotin (ARP74158_P050-Biotin)
Your Rating
Aviva Pathways
Aviva ChIP Antibodies
Aviva Validation Data
Assay Development