Search Antibody, Protein, and ELISA Kit Solutions

PYGM Antibody - C-terminal region (ARP74158_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74158_P050-FITC Conjugated

ARP74158_P050-HRP Conjugated

ARP74158_P050-Biotin Conjugated

Gene Symbol:
PYGM
NCBI Gene Id:
5837
Swissprot Id:
P11217-2
Alias Symbols:
PYGM,
Replacement Item:
This antibody may replace item sc-130860 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
754
Molecular Weight:
82kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PYGM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PYGM.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PYGM
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: TIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
WDYHV1; PRKAB2; UBC; S100A1; TOP1; PPP2R5A; Ccdc15; PYGM; TRIM63; PACSIN3; DEGS1;
Blocking Peptide:
For anti-PYGM (ARP74158_P050) antibody is Catalog # AAP74158
Datasheets/Manuals:
Printable datasheet for anti-PYGM (ARP74158_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...